Cw-type zinc finger of zcwpw2 in complex with the amino terminus of histone h3
PDB DOI: 10.2210/pdb4o62/pdb
Classification: METAL/DNA BINDING PROTEIN Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2013-12-20 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Dong, A. , Edwards, A.M. , Liu, Y. , Loppnau, P. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W. , Weigelt, J.
Cw-type zinc finger of zcwpw2 in complex with the amino terminus of histone h3
Arrowsmith, C.H. , Bountra, C. , Dong, A. , Edwards, A.M. , Liu, Y. , Loppnau, P. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W. , Weigelt, J.
Primary Citation of Related Structures: 4O62
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Zinc finger CW-type PWWP domain protein 2 | A | 59 | Homo Sapiens , Synthetic Construct | GVENMYVNKVWVQCENENCLKWRLLSSEDSAKVDHDEPWYCFMNTDSRYNNCSISEEDF |
| Zinc finger CW-type PWWP domain protein 2 | B | 59 | Homo Sapiens , Synthetic Construct | GVENMYVNKVWVQCENENCLKWRLLSSEDSAKVDHDEPWYCFMNTDSRYNNCSISEEDF |
| Zinc finger CW-type PWWP domain protein 2 | C | 59 | Homo Sapiens , Synthetic Construct | GVENMYVNKVWVQCENENCLKWRLLSSEDSAKVDHDEPWYCFMNTDSRYNNCSISEEDF |
| Histone H3.3 | D | 11 | Homo Sapiens , Synthetic Construct | ARTKQTARKST |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-12-20 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Dong, A. , Edwards, A.M. , Liu, Y. , Loppnau, P. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W. , Weigelt, J.