Crystal structure of t-cell lymphoma invasion and metastasis-1 pdz domain quadruple mutant (qm) in complex with neurexin-1 peptide
PDB DOI: 10.2210/pdb4nxr/pdb
Classification: signaling Protein/Peptide Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2013-12-09 Deposition Author(s): Fuentes, E.J. , Hengel, S.R. , Liu, X. , Shepherd, T.R. , Speckhard, D.C.
Crystal structure of t-cell lymphoma invasion and metastasis-1 pdz domain quadruple mutant (qm) in complex with neurexin-1 peptide
Fuentes, E.J. , Hengel, S.R. , Liu, X. , Shepherd, T.R. , Speckhard, D.C.
Primary Citation of Related Structures: 4NXR
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| T-lymphoma invasion and metastasis-inducing protein 1 | A | 94 | Homo Sapiens , Synthetic Construct | GAMGKVTHSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSMMEDFFSQPSVGLLVRTYPEL |
| Neurexin-2-beta Peptide | B | 8 | Homo Sapiens , Synthetic Construct | NKDKEYYV |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-12-09 Deposition Author(s): Fuentes, E.J. , Hengel, S.R. , Liu, X. , Shepherd, T.R. , Speckhard, D.C.