Crystal structure of human von willebrand factor ctck domain
PDB DOI: 10.2210/pdb4nt5/pdb
Classification: PROTEIN BINDING Organism(s): Homo Sapiens
Deposited: 2013-12-01 Deposition Author(s): Springer, T.A. , Zhou, Y.F.
Method: X-RAY DIFFRACTION Resolution: 3.281 Å
Crystal structure of human von willebrand factor ctck domain
Primary Citation of Related Structures: 4NT5
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| von Willebrand factor | A | 107 | Homo Sapiens | HHHHHHLEVLFQGPEPECNDITARLQYVKVGSCKSEVEVDIHYCQGKCASKAMYSIDINDVQDQCSCCSPTRTEPMQVALHCTNGSVVYHEVLNAMECKCSPRKCSK |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-12-01 Deposition Author(s): Springer, T.A. , Zhou, Y.F.