Crystal structure of hiv-1 protease multiple mutant p51 complexed with darunavir
PDB DOI: 10.2210/pdb4npt/pdb
Classification: HYDROLASE Organism(s): Human Immunodeficiency Virus 1
Deposited: 2013-11-22 Deposition Author(s): Weber, I.T. , Zhang, Y.
Crystal structure of hiv-1 protease multiple mutant p51 complexed with darunavir
Primary Citation of Related Structures: 4NPT
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protease | A | 99 | Human Immunodeficiency Virus 1 | PQITLWKRPIVTIKVGGQLREALINTGADDTIFEEISLPGRWKPKLIGGIGGFMKVRQYDQIPIEIAGHKAIGTVLVGPTPINVIGRNMLTQIGATLNF |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-11-22 Deposition Author(s): Weber, I.T. , Zhang, Y.