Crystal structure of the 1st ig domain from mouse polymeric immunoglobulin receptor [psi-nysgrc-006220]
PDB DOI: 10.2210/pdb4nob/pdb
Classification: IMMUNE SYSTEM Organism(s): Mus Musculus
Deposited: 2013-11-19 Deposition Author(s): Almo, S.C. , Atoms-To-Animals: The Immune Function Network (Ifn) , Attonito, J. , Banu, R. , Bhosle, R. , Calarese, D.A. , Casadevall, A. , Celikgil, A. , Chamala, S. , Chan, M.K. , Chowdhury, S. , Fiser, A. , Garforth, S.J. , Glenn, A.S. , Hillerich, B. , Khafizov, K. , Kumar, P.R. , Love, J.D. , New York Structural Genomics Research Consortium (Nysgrc) , Patel, H. , Patel, R. , Seidel, R.D. , Smith, B. , Stead, M.
Crystal structure of the 1st ig domain from mouse polymeric immunoglobulin receptor [psi-nysgrc-006220]
Almo, S.C. , Atoms-To-Animals: The Immune Function Network (Ifn) , Attonito, J. , Banu, R. , Bhosle, R. , Calarese, D.A. , Casadevall, A. , Celikgil, A. , Chamala, S. , Chan, M.K. , Chowdhury, S. , Fiser, A. , Garforth, S.J. , Glenn, A.S. , Hillerich, B. , Khafizov, K. , Kumar, P.R. , Love, J.D. , New York Structural Genomics Research Consortium (Nysgrc) , Patel, H. , Patel, R. , Seidel, R.D. , Smith, B. , Stead, M.
Primary Citation of Related Structures: 4NOB
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Polymeric immunoglobulin receptor | A | 126 | Mus Musculus | QDYGGSPIFGPQEVSSIEGDSVSITCYYPDTSVNRHTRKYWCRQGASGMCTTLISSNGYLSKEYSGRANLINFPENNTFVINIEQLTQDDTGSYKCGLGTSNRGLSFDVSLEVSQVPELAENLYFQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-11-19 Deposition Author(s): Almo, S.C. , Atoms-To-Animals: The Immune Function Network (Ifn) , Attonito, J. , Banu, R. , Bhosle, R. , Calarese, D.A. , Casadevall, A. , Celikgil, A. , Chamala, S. , Chan, M.K. , Chowdhury, S. , Fiser, A. , Garforth, S.J. , Glenn, A.S. , Hillerich, B. , Khafizov, K. , Kumar, P.R. , Love, J.D. , New York Structural Genomics Research Consortium (Nysgrc) , Patel, H. , Patel, R. , Seidel, R.D. , Smith, B. , Stead, M.