Cftr associated ligand (cal)pdz domain bound to peptide ical36(flb-k-1) (ansrwpts[4-fluorobenzoic-acyl-k]i)
PDB DOI: 10.2210/pdb4nms/pdb
Classification: protein transport/inhibitor Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2013-11-15 Deposition Author(s): Amacher, J.F. , Madden, D.R.
Method: X-RAY DIFFRACTION Resolution: 1.7 Å
Cftr associated ligand (cal)pdz domain bound to peptide ical36(flb-k-1) (ansrwpts[4-fluorobenzoic-acyl-k]i)
Primary Citation of Related Structures: 4NMS
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Golgi-associated PDZ and coiled-coil motif-containing protein | A | 87 | Homo Sapiens , Synthetic Construct | GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV |
| Golgi-associated PDZ and coiled-coil motif-containing protein | B | 87 | Homo Sapiens , Synthetic Construct | GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV |
| iCAL36(FLB-K-1) peptide | C | 10 | Homo Sapiens , Synthetic Construct | ANSRWPTSKI |
| iCAL36(FLB-K-1) peptide | D | 10 | Homo Sapiens , Synthetic Construct | ANSRWPTSKI |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-11-15 Deposition Author(s): Amacher, J.F. , Madden, D.R.