Cftr associated ligand (cal) pdz domain bound to peptide ical36(ac-k-3) (ansrwp[ac-k]sii)
PDB DOI: 10.2210/pdb4nmp/pdb
Classification: protein transport/inhibitor Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2013-11-15 Deposition Author(s): Amacher, J.F. , Madden, D.R.
Method: X-RAY DIFFRACTION Resolution: 1.3 Å
Cftr associated ligand (cal) pdz domain bound to peptide ical36(ac-k-3) (ansrwp[ac-k]sii)
Primary Citation of Related Structures: 4NMP
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Golgi-associated PDZ and coiled-coil motif-containing protein | A | 87 | Homo Sapiens , Synthetic Construct | GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV |
Golgi-associated PDZ and coiled-coil motif-containing protein | B | 87 | Homo Sapiens , Synthetic Construct | GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV |
iCAL36(Ac-K-3) peptide | C | 10 | Homo Sapiens , Synthetic Construct | ANSRWPKSII |
iCAL36(Ac-K-3) peptide | D | 10 | Homo Sapiens , Synthetic Construct | ANSRWPKSII |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-11-15 Deposition Author(s): Amacher, J.F. , Madden, D.R.