Structure of blmi, a type-ii acyl-carrier-protein from streptomyces verticillus involved in bleomycin biosynthesis
PDB DOI: 10.2210/pdb4neo/pdb
Classification: LIGASE Organism(s): Streptomyces Verticillus
Deposited: 2013-10-29 Deposition Author(s): Babnigg, G. , Bearden, J. , Bigelow, L. , Bingman, C.A. , Bruno, C.J.P. , Cuff, M.E. , Enzyme Discovery For Natural Product Biosynthesis (Natpro) , Joachimiak, A. , Lohman, J. , Ma, M. , Midwest Center For Structural Genomics (Mcsg) , Phillips Jr., G.N. , Shen, B. , Yennamalli, R.
Structure of blmi, a type-ii acyl-carrier-protein from streptomyces verticillus involved in bleomycin biosynthesis
Babnigg, G. , Bearden, J. , Bigelow, L. , Bingman, C.A. , Bruno, C.J.P. , Cuff, M.E. , Enzyme Discovery For Natural Product Biosynthesis (Natpro) , Joachimiak, A. , Lohman, J. , Ma, M. , Midwest Center For Structural Genomics (Mcsg) , Phillips Jr., G.N. , Shen, B. , Yennamalli, R.
Primary Citation of Related Structures: 4NEO
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Peptide synthetase NRPS type II-PCP | A | 93 | Streptomyces Verticillus | SNAMSAPRGERTRRRALERDIAAIWAETLGRDSVGPHEDFAALGGNSIHAIKITNRVEELVDAELSIRVLLETRTVAGMTDHVHATLTGERDR |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-10-29 Deposition Author(s): Babnigg, G. , Bearden, J. , Bigelow, L. , Bingman, C.A. , Bruno, C.J.P. , Cuff, M.E. , Enzyme Discovery For Natural Product Biosynthesis (Natpro) , Joachimiak, A. , Lohman, J. , Ma, M. , Midwest Center For Structural Genomics (Mcsg) , Phillips Jr., G.N. , Shen, B. , Yennamalli, R.