Crystal structure of the chemokine receptor cxcr2 in complex with the first pdz domain of nherf1
PDB DOI: 10.2210/pdb4n6x/pdb
Classification: SIGNALING PROTEIN Organism(s): Salmonella Enterica
Deposited: 2013-10-14 Deposition Author(s): Brunzelle, J. , Jiang, Y. , Li, C. , Lu, G. , Sirinupong, N. , Wu, Y. , Yang, Z.
Crystal structure of the chemokine receptor cxcr2 in complex with the first pdz domain of nherf1
Brunzelle, J. , Jiang, Y. , Li, C. , Lu, G. , Sirinupong, N. , Wu, Y. , Yang, Z.
Primary Citation of Related Structures: 4N6X
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Na(+)/H(+) exchange regulatory cofactor NHE-RF1/Chemokine Receptor CXCR2 fusion protein | A | 91 | Salmonella Enterica | GMLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETSTTL |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-10-14 Deposition Author(s): Brunzelle, J. , Jiang, Y. , Li, C. , Lu, G. , Sirinupong, N. , Wu, Y. , Yang, Z.