4N5T
The 1.7a crystal structure of mdmx with a stapled peptide, atsp-7041
PDB DOI: 10.2210/pdb4n5t/pdb
Classification: CELL CYCLE/CELL CYCLE INHIBITOR Organism(s): Bacillus Caldotenax , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2013-10-10 Deposition Author(s): Graves, B.J. , Janson, C.A. , Lukacs, C.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.7 Å
The 1.7a crystal structure of mdmx with a stapled peptide, atsp-7041
Graves, B.J. , Janson, C.A. , Lukacs, C.
Primary Citation of Related Structures: 4N5T
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protein Mdm4 | A | 90 | Bacillus Caldotenax , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | LPGEGTQVHPRAPLLQILKVAGAQEEVFTVKEVMHYLGQYIMMKQLYDKQRQHIVHCHDDPLGELLEVGSFSVKNPSPLYEMLKRNLVIL |
| ATSP-7041 stapled-peptide | B | 15 | Bacillus Caldotenax , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XLTFXEYWAQXLSAA |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2013-10-10 Deposition Author(s): Graves, B.J. , Janson, C.A. , Lukacs, C.