Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bam_6123), target efi-510059, with bound beta-d-galacturonate
PDB DOI: 10.2210/pdb4n17/pdb
Classification: TRANSPORT PROTEIN Organism(s): Burkholderia Ambifaria
Deposited: 2013-10-03 Deposition Author(s): Al Obaidi, N.F. , Almo, S.C. , Attonito, J.D. , Bhosle, R. , Chowdhury, S. , Enzyme Function Initiative (Efi) , Evans, B. , Gerlt, J.A. , Hillerich, B. , Imker, H.J. , Jacobson, M.P. , Love, J. , Scott Glenn, A. , Seidel, R.D. , Stead, M. , Toro, R. , Vetting, M.W. , Zhao, S.
Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bam_6123), target efi-510059, with bound beta-d-galacturonate
Al Obaidi, N.F. , Almo, S.C. , Attonito, J.D. , Bhosle, R. , Chowdhury, S. , Enzyme Function Initiative (Efi) , Evans, B. , Gerlt, J.A. , Hillerich, B. , Imker, H.J. , Jacobson, M.P. , Love, J. , Scott Glenn, A. , Seidel, R.D. , Stead, M. , Toro, R. , Vetting, M.W. , Zhao, S.
Primary Citation of Related Structures: 4N17
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| TRAP dicarboxylate transporter, DctP subunit | A | 335 | Burkholderia Ambifaria | MTHRFPRSRTALAVALMAGFAMSAQARVFRSADVHGDSFPTNMAVKFMGDELSKLTGGKDSIKVFGNSALGSEKDTVDQVRIGAIDMARVNGASFNEIVPESLIPSFPFLFRDVDHFRKAMYGPAGQKILDAFAAKGMIALTFYESGARSIYAKRPVRTPADMKGLKVRVQPSDLMVDEIRAMGGTPTPMPFAEVYTGLKTGLVDAAENNLPSYEETKHFEVAPDYSETQHAMTPEVLVFSKKIWDTLSPQEQAAIRKAAADSVPYYQKLWTAREASAQQAVTKGGANILPAAQVDRAAFVKAMQPLWTKYEKTPQMKQIVDEIEATKAENLYFQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-10-03 Deposition Author(s): Al Obaidi, N.F. , Almo, S.C. , Attonito, J.D. , Bhosle, R. , Chowdhury, S. , Enzyme Function Initiative (Efi) , Evans, B. , Gerlt, J.A. , Hillerich, B. , Imker, H.J. , Jacobson, M.P. , Love, J. , Scott Glenn, A. , Seidel, R.D. , Stead, M. , Toro, R. , Vetting, M.W. , Zhao, S.