PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

4MZL

Crystal structure of mtip from plasmodium falciparum in complex with hbs myoa, a hydrogen bond surrogate myoa helix mimetic

PDB DOI: 10.2210/pdb4mzl/pdb

Classification: PROTEIN BINDING/INHIBITOR
Organism(s): Clostridium Botulinum C Phage , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)

Deposited: 2013-09-30
Deposition Author(s): Cota, E. , Douse, C.H. , Garnett, J.A. , Maas, S.J. , Tate, E.W.

Experimental Data Snapshot

Method: X-RAY DIFFRACTION
Resolution: 2.01 Å

4mzl
Literature

Crystal structure of mtip from plasmodium falciparum in complex with hbs myoa, a hydrogen bond surrogate myoa helix mimetic

Cota, E. , Douse, C.H. , Garnett, J.A. , Maas, S.J. , Tate, E.W.

Primary Citation of Related Structures: 4MZL


Proteins
Molecule Chains Sequence Length Organism Sequence
Myosin A tail domain interacting protein A 145 Clostridium Botulinum C Phage , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) GSVADIQQLEEKVDESDVRIYFNEKSSGGKISIDNASYNARKLGLAPSSIDEKKIKELYGDNLTYEQYLEYLSICVHDKDNVEELIKMFAHFDNNCTGYLTKSQMKNILTTWGDALTDQEAIDALNAFSSEDNIDYKLFCEDILQ
Myosin A tail domain interacting protein B 145 Clostridium Botulinum C Phage , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) GSVADIQQLEEKVDESDVRIYFNEKSSGGKISIDNASYNARKLGLAPSSIDEKKIKELYGDNLTYEQYLEYLSICVHDKDNVEELIKMFAHFDNNCTGYLTKSQMKNILTTWGDALTDQEAIDALNAFSSEDNIDYKLFCEDILQ
hydrogen bond surrogate (HBS) myoA helix mimetic C 17 Clostridium Botulinum C Phage , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) NIXSLLRVQAHIRKKMV
hydrogen bond surrogate (HBS) myoA helix mimetic D 17 Clostridium Botulinum C Phage , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) NIXSLLRVQAHIRKKMV
Experimental Data

Method: X-RAY DIFFRACTION

Deposited Date: 2013-09-30
Deposition Author(s): Cota, E. , Douse, C.H. , Garnett, J.A. , Maas, S.J. , Tate, E.W.