4MZK
Crystal structure of mtip from plasmodium falciparum in complex with pgly[807,811], a stapled myoa tail peptide
PDB DOI: 10.2210/pdb4mzk/pdb
Classification: PROTEIN BINDING/inhibitor Organism(s): Citrus Unshiu , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2013-09-30 Deposition Author(s): Cota, E. , Douse, C.H. , Garnett, J.A. , Maas, S.J. , Tate, E.W.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.82 Å
Crystal structure of mtip from plasmodium falciparum in complex with pgly[807,811], a stapled myoa tail peptide
Cota, E. , Douse, C.H. , Garnett, J.A. , Maas, S.J. , Tate, E.W.
Primary Citation of Related Structures: 4MZK
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Myosin A tail domain interacting protein | A | 145 | Citrus Unshiu , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSVADIQQLEEKVDESDVRIYFNEKSSGGKISIDNASYNARKLGLAPSSIDEKKIKELYGDNLTYEQYLEYLSICVHDKDNVEELIKMFAHFDNNCTGYLTKSQMKNILTTWGDALTDQEAIDALNAFSSEDNIDYKLFCEDILQ |
| pGly[807,811], a stapled myoA tail peptide | T | 19 | Citrus Unshiu , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XKNIPSLLRLQAHLRKKMV |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2013-09-30 Deposition Author(s): Cota, E. , Douse, C.H. , Garnett, J.A. , Maas, S.J. , Tate, E.W.