Comparison of the nmr solution structure and the x-ray crystal structure of rat metallothionein-2
PDB DOI: 10.2210/pdb4mt2/pdb
Classification: METALLOTHIONEIN Organism(s): Rattus Rattus
Deposited: 1993-02-26 Deposition Author(s): Robbins, A.H. , Stout, C.D.
Comparison of the nmr solution structure and the x-ray crystal structure of rat metallothionein-2
Primary Citation of Related Structures: 4MT2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| METALLOTHIONEIN ISOFORM II | A | 62 | Rattus Rattus | XMDPNCSCATDGSCSCAGSCKCKQCKCTSCKKSCCSCCPVGCAKCSQGCICKEASDKCSCCA |
Method: X-RAY DIFFRACTION
Deposited Date: 1993-02-26 Deposition Author(s): Robbins, A.H. , Stout, C.D.