4MQV
Crystal complex of rpa32c and smarcal1 n-terminus
PDB DOI: 10.2210/pdb4mqv/pdb
Classification: PROTEIN BINDING Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2013-09-16 Deposition Author(s): Qian, C.M. , Xie, S.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.95 Å
Crystal complex of rpa32c and smarcal1 n-terminus
Primary Citation of Related Structures: 4MQV
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Replication protein A 32 kDa subunit | A | 69 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE |
| Replication protein A 32 kDa subunit | C | 69 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE |
| SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 | B | 26 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | LTEEQRKKIEENRQKALARRAEKLLA |
| SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 | D | 26 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | LTEEQRKKIEENRQKALARRAEKLLA |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2013-09-16 Deposition Author(s): Qian, C.M. , Xie, S.