Crystal structure of etv6 bound to a specific dna sequence
PDB DOI: 10.2210/pdb4mhg/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Mus Musculus , Synthetic Construct
Deposited: 2013-08-29 Deposition Author(s): Chan, A.C. , Coyne Iii, H.J. , De, S. , Graves, B.J. , Mcintosh, L.P. , Murphy, M.E. , Okon, M.
Crystal structure of etv6 bound to a specific dna sequence
Chan, A.C. , Coyne Iii, H.J. , De, S. , Graves, B.J. , Mcintosh, L.P. , Murphy, M.E. , Okon, M.
Primary Citation of Related Structures: 4MHG
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcription factor ETV6 | A | 102 | Mus Musculus , Synthetic Construct | GSHMGRIADSRLLWDYVYQLLSDSRYENFIRWEDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLNIIRKEPGQRLLFRFMKTPDEIMSGR |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-08-29 Deposition Author(s): Chan, A.C. , Coyne Iii, H.J. , De, S. , Graves, B.J. , Mcintosh, L.P. , Murphy, M.E. , Okon, M.