Tpr3 of fimv from p. aeruginosa (pao1)
PDB DOI: 10.2210/pdb4mbq/pdb
Classification: UNKNOWN FUNCTION Organism(s): Pseudomonas Aeruginosa
Deposited: 2013-08-19 Deposition Author(s): Burrows, L.L. , Daniel-Ivad, M. , Howell, P.L. , Junop, M.S. , Nguyen, Y. , Robinson, H. , Sugiman-Marangos, S.N. , Wolfram, F. , Zhang, K.
Tpr3 of fimv from p. aeruginosa (pao1)
Burrows, L.L. , Daniel-Ivad, M. , Howell, P.L. , Junop, M.S. , Nguyen, Y. , Robinson, H. , Sugiman-Marangos, S.N. , Wolfram, F. , Zhang, K.
Primary Citation of Related Structures: 4MBQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Motility protein FimV | A | 64 | Pseudomonas Aeruginosa | GIDPFTDDFDFLSGADEAATKLDLARAYIDMGDSEGARDILDEVLAEGNDSQQAEARELLERLA |
| Motility protein FimV | B | 64 | Pseudomonas Aeruginosa | GIDPFTDDFDFLSGADEAATKLDLARAYIDMGDSEGARDILDEVLAEGNDSQQAEARELLERLA |
| Motility protein FimV | C | 64 | Pseudomonas Aeruginosa | GIDPFTDDFDFLSGADEAATKLDLARAYIDMGDSEGARDILDEVLAEGNDSQQAEARELLERLA |
| Motility protein FimV | D | 64 | Pseudomonas Aeruginosa | GIDPFTDDFDFLSGADEAATKLDLARAYIDMGDSEGARDILDEVLAEGNDSQQAEARELLERLA |
| Motility protein FimV | E | 64 | Pseudomonas Aeruginosa | GIDPFTDDFDFLSGADEAATKLDLARAYIDMGDSEGARDILDEVLAEGNDSQQAEARELLERLA |
| Motility protein FimV | F | 64 | Pseudomonas Aeruginosa | GIDPFTDDFDFLSGADEAATKLDLARAYIDMGDSEGARDILDEVLAEGNDSQQAEARELLERLA |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-08-19 Deposition Author(s): Burrows, L.L. , Daniel-Ivad, M. , Howell, P.L. , Junop, M.S. , Nguyen, Y. , Robinson, H. , Sugiman-Marangos, S.N. , Wolfram, F. , Zhang, K.