Structure of klf4 zinc finger dna binding domain in complex with methylated dna
PDB DOI: 10.2210/pdb4m9e/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2013-08-14 Deposition Author(s): Blumenthal, R.M. , Cheng, X. , Liu, Y. , Olanrewaju, Y.O. , Zhang, X.
Structure of klf4 zinc finger dna binding domain in complex with methylated dna
Blumenthal, R.M. , Cheng, X. , Liu, Y. , Olanrewaju, Y.O. , Zhang, X.
Primary Citation of Related Structures: 4M9E
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Krueppel-like factor 4 | A | 88 | Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | RTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-08-14 Deposition Author(s): Blumenthal, R.M. , Cheng, X. , Liu, Y. , Olanrewaju, Y.O. , Zhang, X.