4LUP
Crystal structure of the complex formed by region of e. coli sigmae bound to its -10 element non template strand
PDB DOI: 10.2210/pdb4lup/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Adineta Vaga , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2013-07-25 Deposition Author(s): Allain, F.H.-T. , Campagne, S. , Capitani, G. , Marsh, M.E. , Vorholt, J.A.V.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.2 Å
Crystal structure of the complex formed by region of e. coli sigmae bound to its -10 element non template strand
Allain, F.H.-T. , Campagne, S. , Capitani, G. , Marsh, M.E. , Vorholt, J.A.V.
Primary Citation of Related Structures: 4LUP
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| RNA polymerase sigma factor | A | 106 | Adineta Vaga , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MSEQLTDQVLVERVQKGDQKAFNLLVVRYQHKVASLVSRYVPSGDVPDVVQEAFIKAYRALDSFRGDSAFYTWLYRIAVNTAKNYLVAQGRRLELVPRGSHHHHHH |
| RNA polymerase sigma factor | C | 106 | Adineta Vaga , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MSEQLTDQVLVERVQKGDQKAFNLLVVRYQHKVASLVSRYVPSGDVPDVVQEAFIKAYRALDSFRGDSAFYTWLYRIAVNTAKNYLVAQGRRLELVPRGSHHHHHH |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2013-07-25 Deposition Author(s): Allain, F.H.-T. , Campagne, S. , Capitani, G. , Marsh, M.E. , Vorholt, J.A.V.