Crystal structure of ligand binding domain of cysb, a lysr member from salmonella typhimurium in complex with effector ligand, o-acetylserine
PDB DOI: 10.2210/pdb4lq2/pdb
Classification: GENE REGULATION Organism(s): Salmonella Enterica Subsp. Enterica Serovar Typhimurium
Deposited: 2013-07-17 Deposition Author(s): Kumaran, S. , Mittal, M. , Singh, A.K.
Crystal structure of ligand binding domain of cysb, a lysr member from salmonella typhimurium in complex with effector ligand, o-acetylserine
Kumaran, S. , Mittal, M. , Singh, A.K.
Primary Citation of Related Structures: 4LQ2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| HTH-type transcriptional regulator CysB | A | 245 | Salmonella Enterica Subsp. Enterica Serovar Typhimurium | HHHHHHEHTWPDKGSLYIATTHTQARYALPGVIKGFIERYPRVSLHMHQGSPTQIAEAVSKGNADFAIATEALHLYDDLVMLPCYHWNRSIVVTPDHPLAATSSVTIEALAQYPLVTYTFGFTGRSELDTAFNRAGLTPRIVFTATDADVIKTYVRLGLGVGVIASMAVDPLADPDLVRIDAHDIFSHSTTKIGFRRSTFLRSYMYDFIQRFAPHLTRDVVDTAVALRSNEEIEAMFQDIKLPEK |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-07-17 Deposition Author(s): Kumaran, S. , Mittal, M. , Singh, A.K.