The first sh3 domain from cap/ponsin in complex with proline rich peptide from vinculin
PDB DOI: 10.2210/pdb4lnp/pdb
Classification: SIGNALING PROTEIN Organism(s): Salmonella Enterica
Deposited: 2013-07-11 Deposition Author(s): Gong, Q. , Li, F. , Shi, Y. , Wu, J. , Zhang, Z. , Zhao, D.
Method: X-RAY DIFFRACTION Resolution: 1.41 Å
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Sorbin and SH3 domain-containing protein 1 | A | 61 | Salmonella Enterica | EMRPARAKFDFKAQTLKELPLQKGDIVYIYKQIDQNWYEGEHHGRVGIFPRTYIELLPPAE |
Vinculin | B | 10 | Salmonella Enterica | VPPPRPPPPE |
Method: X-RAY DIFFRACTION