4LKF
Crystal structure of pseudomonas aeruginosa lectin leca complexed with gala-wky at 1.64 a resolution
PDB DOI: 10.2210/pdb4lkf/pdb
Classification: SUGAR BINDING PROTEIN/INHIBITOR Organism(s): Vibrio Nigripulchritudo , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2013-07-07 Deposition Author(s): Kadam, R.U. , Reymond, J.-L. , Stocker, A.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.64 Å
Crystal structure of pseudomonas aeruginosa lectin leca complexed with gala-wky at 1.64 a resolution
Kadam, R.U. , Reymond, J.-L. , Stocker, A.
Primary Citation of Related Structures: 4LKF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PA-I galactophilic lectin | A | 121 | Vibrio Nigripulchritudo , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS |
| PA-I galactophilic lectin | B | 121 | Vibrio Nigripulchritudo , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS |
| peptide WKYL | C | 4 | Vibrio Nigripulchritudo , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | WKYL |
| peptide WKYL | D | 4 | Vibrio Nigripulchritudo , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | WKYL |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2013-07-07 Deposition Author(s): Kadam, R.U. , Reymond, J.-L. , Stocker, A.