Crystal structure of c-terminal rna recognition motif of human etr3
PDB DOI: 10.2210/pdb4ljm/pdb
Classification: RNA BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2013-07-05 Deposition Author(s): Bhavesh, N.S. , Kashyap, M. , Sharma, A. , Yogavel, M.
Crystal structure of c-terminal rna recognition motif of human etr3
Bhavesh, N.S. , Kashyap, M. , Sharma, A. , Yogavel, M.
Primary Citation of Related Structures: 4LJM
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| CUGBP Elav-like family member 2 | B | 97 | Homo Sapiens | GSHMQKEGPEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDSKPY |
| CUGBP Elav-like family member 2 | A | 97 | Homo Sapiens | GSHMQKEGPEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDSKPY |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-07-05 Deposition Author(s): Bhavesh, N.S. , Kashyap, M. , Sharma, A. , Yogavel, M.