Ripd (rv1566c) from mycobacterium tuberculosis: a non-catalytic nlpc/p60 domain protein with two penta-peptide repeat units (pvqqa-pvqpa)
PDB DOI: 10.2210/pdb4lj1/pdb
Classification: CELL INVASION Organism(s): Mycobacterium Tuberculosis
Deposited: 2013-07-04 Deposition Author(s): Both, D. , Linder, D.C. , Schneider, G. , Schnell, R. , Steiner, E.M.
Method: X-RAY DIFFRACTION Resolution: 1.17 Å
Ripd (rv1566c) from mycobacterium tuberculosis: a non-catalytic nlpc/p60 domain protein with two penta-peptide repeat units (pvqqa-pvqpa)
Both, D. , Linder, D.C. , Schneider, G. , Schnell, R. , Steiner, E.M.
Primary Citation of Related Structures: 4LJ1
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Invasion-associated protein | A | 147 | Mycobacterium Tuberculosis | SMDYQQITDVVIARGLSQRGVPFSWAGGGISGPTRGTGTGINTVGFDASGLIQYAYAGAGLKLPRSSGQMYKVGQKVLPQQARKGDLIFYGPEGTQSVALYLGKGQMLEVGDVVQVSPVRTNGMTPYLVRVLGTQPTPVQQAPVQPA |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-07-04 Deposition Author(s): Both, D. , Linder, D.C. , Schneider, G. , Schnell, R. , Steiner, E.M.