Crystal structure mbd4 mbd domain in complex with methylated cpg dna
PDB DOI: 10.2210/pdb4lg7/pdb
Classification: HYDROLASE/DNA Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2013-06-27 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W. , Wernimont, A.K. , Xu, C.
Method: X-RAY DIFFRACTION Resolution: 2.5 Å
Crystal structure mbd4 mbd domain in complex with methylated cpg dna
Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W. , Wernimont, A.K. , Xu, C.
Primary Citation of Related Structures: 4LG7
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Methyl-CpG-binding domain protein 4 | A | 68 | Homo Sapiens , Synthetic Construct | GRKSVPCGWERVVKQRLFGKTAGRFDVYFISPQGLKFRSKSSLANYLHKNGETSLKPEDFDFTVLSKR |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-06-27 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W. , Wernimont, A.K. , Xu, C.