Crystal structure of the bromodomain of human brpf1b
PDB DOI: 10.2210/pdb4lc2/pdb
Classification: DNA BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2013-06-21 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Filippakopoulos, P. , Knapp, S. , Nunez-Alonso, G. , Picaud, S. , Savitsky, P. , Structural Genomics Consortium (Sgc) , Tallant, C. , Von Delft, F.
Crystal structure of the bromodomain of human brpf1b
Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Filippakopoulos, P. , Knapp, S. , Nunez-Alonso, G. , Picaud, S. , Savitsky, P. , Structural Genomics Consortium (Sgc) , Tallant, C. , Von Delft, F.
Primary Citation of Related Structures: 4LC2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Peregrin | A | 116 | Homo Sapiens | SMEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMG |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-06-21 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Filippakopoulos, P. , Knapp, S. , Nunez-Alonso, G. , Picaud, S. , Savitsky, P. , Structural Genomics Consortium (Sgc) , Tallant, C. , Von Delft, F.