4L7X
Crystal structure of the dido phd finger in complex with h3k4me3
PDB DOI: 10.2210/pdb4l7x/pdb
Classification: CELL CYCLE, GENE REGULATION Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2013-06-14 Deposition Author(s): Gatchalian, J. , Kutateladze, T.G. , Tong, Q.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.35 Å
Crystal structure of the dido phd finger in complex with h3k4me3
Gatchalian, J. , Kutateladze, T.G. , Tong, Q.
Primary Citation of Related Structures: 4L7X
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Death-inducer obliterator 1 | A | 63 | Homo Sapiens , Synthetic Construct | GPLPNALYCICRQPHNNRFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCTILQVQ |
| Histone H3 peptide | U | 12 | Homo Sapiens , Synthetic Construct | ARTKQTARKSTG |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2013-06-14 Deposition Author(s): Gatchalian, J. , Kutateladze, T.G. , Tong, Q.