4L5E
Crystal structure of a. aeolicus ntrc1 dna binding domain
PDB DOI: 10.2210/pdb4l5e/pdb
Classification: PROTEIN BINDING Organism(s): Aquifex Aeolicus
Deposited: 2013-06-10 Deposition Author(s): Batchelor, J.D. , Hong, E. , Maris, A.E. , Pelton, J.G. , Vidangos, N.K. , Wemmer, D.E. , Young, A.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.34 Å
Crystal structure of a. aeolicus ntrc1 dna binding domain
Batchelor, J.D. , Hong, E. , Maris, A.E. , Pelton, J.G. , Vidangos, N.K. , Wemmer, D.E. , Young, A.
Primary Citation of Related Structures: 4L5E
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcriptional regulator (NtrC family) | A | 46 | Aquifex Aeolicus | HKSIKEIEKEEIIKVLKEVNFNKKLASEILGIPLRTLYKRLKEYGI |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2013-06-10 Deposition Author(s): Batchelor, J.D. , Hong, E. , Maris, A.E. , Pelton, J.G. , Vidangos, N.K. , Wemmer, D.E. , Young, A.