4L58
Crystal structure of the mll5 phd finger in complex with h3k4me3
PDB DOI: 10.2210/pdb4l58/pdb
Classification: TRANSFERASE Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2013-06-10 Deposition Author(s): Ali, M. , Kutateladze, T.G. , Tong, Q.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.48 Å
Crystal structure of the mll5 phd finger in complex with h3k4me3
Ali, M. , Kutateladze, T.G. , Tong, Q.
Primary Citation of Related Structures: 4L58
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Histone-lysine N-methyltransferase MLL5 | A | 69 | Homo Sapiens , Synthetic Construct | GSHMDVTRCICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPDTYLCERCQPRNLDKERAVLLQRRKR |
| Histone H3 peptide | B | 12 | Homo Sapiens , Synthetic Construct | ARTKQTARKSTG |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2013-06-10 Deposition Author(s): Ali, M. , Kutateladze, T.G. , Tong, Q.