Investigating the functional significance of the interlocked pair structural determinants in pseudomonas aeruginosa azurin (v31i/v95k/y108f)
PDB DOI: 10.2210/pdb4ko6/pdb
Classification: ELECTRON TRANSPORT Organism(s): Pseudomonas Aeruginosa
Deposited: 2013-05-11 Deposition Author(s): Inampudi, K.K. , Meng, W. , Tobin, P.H. , Wilson, C.J.
Investigating the functional significance of the interlocked pair structural determinants in pseudomonas aeruginosa azurin (v31i/v95k/y108f)
Inampudi, K.K. , Meng, W. , Tobin, P.H. , Wilson, C.J.
Primary Citation of Related Structures: 4KO6
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Azurin | A | 128 | Pseudomonas Aeruginosa | AECSVDIQGNDQMQFNTNAITVDKSCKQFTINLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSKTFDVSKLKEGEQFMFFCTFPGHSALMKGTLTLK |
| Azurin | B | 128 | Pseudomonas Aeruginosa | AECSVDIQGNDQMQFNTNAITVDKSCKQFTINLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSKTFDVSKLKEGEQFMFFCTFPGHSALMKGTLTLK |
| Azurin | C | 128 | Pseudomonas Aeruginosa | AECSVDIQGNDQMQFNTNAITVDKSCKQFTINLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSKTFDVSKLKEGEQFMFFCTFPGHSALMKGTLTLK |
| Azurin | D | 128 | Pseudomonas Aeruginosa | AECSVDIQGNDQMQFNTNAITVDKSCKQFTINLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSKTFDVSKLKEGEQFMFFCTFPGHSALMKGTLTLK |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-05-11 Deposition Author(s): Inampudi, K.K. , Meng, W. , Tobin, P.H. , Wilson, C.J.