Backbone modifications in the protein gb1 turns: aib10, d-pro47
PDB DOI: 10.2210/pdb4kgt/pdb
Classification: DE NOVO PROTEIN Organism(s): N.A.
Deposited: 2013-04-29 Deposition Author(s): Horne, W.S. , Lengyel, G.A. , Reinert, Z.E.
Method: X-RAY DIFFRACTION Resolution: 2 Å
Backbone modifications in the protein gb1 turns: aib10, d-pro47
Horne, W.S. , Lengyel, G.A. , Reinert, Z.E.
Primary Citation of Related Structures: 4KGT
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Streptococcal Protein GB1 Backbone Modified Variant: Aib10, D-Pro47 | A | 55 | N.A. | DTYKLILNGAGLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDPGTFTVTEX |
Streptococcal Protein GB1 Backbone Modified Variant: Aib10, D-Pro47 | B | 55 | N.A. | DTYKLILNGAGLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDPGTFTVTEX |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-04-29 Deposition Author(s): Horne, W.S. , Lengyel, G.A. , Reinert, Z.E.