4KG9
Crystal structure of usp7-ntd with mcm-bp
PDB DOI: 10.2210/pdb4kg9/pdb
Classification: HYDROLASE Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2013-04-29 Deposition Author(s): Luthra, N. , Saridakis, V.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.7 Å
Crystal structure of usp7-ntd with mcm-bp
Primary Citation of Related Structures: 4KG9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ubiquitin carboxyl-terminal hydrolase 7 | A | 152 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | TAEEDMEDDTSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDDKVTFEVFVQADAPHGVAW |
| Mini-chromosome maintenance complex-binding protein | B | 10 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | RVSPSTSYTP |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2013-04-29 Deposition Author(s): Luthra, N. , Saridakis, V.