Crystal structure of wild-type hiv-1 protease with novel tricyclic p2-ligands grl-0739a
PDB DOI: 10.2210/pdb4kb9/pdb
Classification: Hydrolase/Hydrolase Inhibitor Organism(s): Human Immunodeficiency Virus 1
Deposited: 2013-04-23 Deposition Author(s): Agniswamy, J. , Wang, Y.-F. , Weber, I.T.
Crystal structure of wild-type hiv-1 protease with novel tricyclic p2-ligands grl-0739a
Agniswamy, J. , Wang, Y.-F. , Weber, I.T.
Primary Citation of Related Structures: 4KB9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protease | A | 99 | Human Immunodeficiency Virus 1 | PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF |
| Protease | B | 99 | Human Immunodeficiency Virus 1 | PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-04-23 Deposition Author(s): Agniswamy, J. , Wang, Y.-F. , Weber, I.T.