Crystal structure of a putative thiol-disulfide oxidoreductase from bacteroides vulgatus (target nysgrc-011676), space group p6222
PDB DOI: 10.2210/pdb4k9z/pdb
Classification: OXIDOREDUCTASE Organism(s): Bacteroides Vulgatus
Deposited: 2013-04-21 Deposition Author(s): Almo, S.C. , Armstrong, R.N. , Bhosle, R. , Bonanno, J.B. , Celikgil, A. , Chamala, S. , Chan, M.K. , Evans, B. , Fiser, A. , Garforth, S. , Gizzi, A. , Hillerich, B. , Kar, A. , Khafizov, K. , Lafluer, J. , Lim, S. , Love, J. , Matikainen, B. , New York Structural Genomics Research Consortium (Nysgrc) , Patel, H. , Patskovsky, Y. , Seidel, R.D. , Toro, R. , Vetting, M.W. , Villegas, G.
Method: X-RAY DIFFRACTION Resolution: 1.8 Å
Crystal structure of a putative thiol-disulfide oxidoreductase from bacteroides vulgatus (target nysgrc-011676), space group p6222
Almo, S.C. , Armstrong, R.N. , Bhosle, R. , Bonanno, J.B. , Celikgil, A. , Chamala, S. , Chan, M.K. , Evans, B. , Fiser, A. , Garforth, S. , Gizzi, A. , Hillerich, B. , Kar, A. , Khafizov, K. , Lafluer, J. , Lim, S. , Love, J. , Matikainen, B. , New York Structural Genomics Research Consortium (Nysgrc) , Patel, H. , Patskovsky, Y. , Seidel, R.D. , Toro, R. , Vetting, M.W. , Villegas, G.
Primary Citation of Related Structures: 4K9Z
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Putative thiol-disulfide oxidoreductase | A | 168 | Bacteroides Vulgatus | MSLNADFATEIEGKIVQASKLLPGQPAIDFEMLDVEGNVKHLADFKGKVIYIDLWATWCGPCIQESPAFEALGKKYVGKDIVFLPVSTDTTTKPWLRYLDGHKKELTQYHSNDVALKESWAIMYIPRFILIDKDFNIVNAYAPRPSSEEIGTLIDSVLNKEGHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-04-21 Deposition Author(s): Almo, S.C. , Armstrong, R.N. , Bhosle, R. , Bonanno, J.B. , Celikgil, A. , Chamala, S. , Chan, M.K. , Evans, B. , Fiser, A. , Garforth, S. , Gizzi, A. , Hillerich, B. , Kar, A. , Khafizov, K. , Lafluer, J. , Lim, S. , Love, J. , Matikainen, B. , New York Structural Genomics Research Consortium (Nysgrc) , Patel, H. , Patskovsky, Y. , Seidel, R.D. , Toro, R. , Vetting, M.W. , Villegas, G.