Cftr associated ligand (cal) pdz domain bound to peptide ical36-vqd (ansrvqdsii)
PDB DOI: 10.2210/pdb4k72/pdb
Classification: PEPTIDE BINDING PROTEIN/PROTEIN BINDING Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2013-04-16 Deposition Author(s): Amacher, J.F. , Madden, D.R.
Cftr associated ligand (cal) pdz domain bound to peptide ical36-vqd (ansrvqdsii)
Primary Citation of Related Structures: 4K72
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Golgi-associated PDZ and coiled-coil motif-containing protein | A | 87 | Homo Sapiens , Synthetic Construct | GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV |
Golgi-associated PDZ and coiled-coil motif-containing protein | B | 87 | Homo Sapiens , Synthetic Construct | GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV |
iCAL36-VQD peptide | C | 10 | Homo Sapiens , Synthetic Construct | ANSRVQDSII |
iCAL36-VQD peptide | D | 10 | Homo Sapiens , Synthetic Construct | ANSRVQDSII |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-04-16 Deposition Author(s): Amacher, J.F. , Madden, D.R.