Auto-inhibition and phosphorylation-induced activation of plc-gamma isozymes
PDB DOI: 10.2210/pdb4k45/pdb
Classification: HYDROLASE/HYDROLASE INHIBITOR Organism(s): Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2013-04-11 Deposition Author(s): Hajicek, N. , Sondek, J.
Method: X-RAY DIFFRACTION Resolution: 1.5 Å
Auto-inhibition and phosphorylation-induced activation of plc-gamma isozymes
Primary Citation of Related Structures: 4K45
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 | A | 106 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SQAESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQEGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGT |
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1, short peptide | B | 18 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | DYGALYEGRNPGFYVEAN |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-04-11 Deposition Author(s): Hajicek, N. , Sondek, J.