Crystal structure of chicken c-src-sh3 domain: monomeric form
PDB DOI: 10.2210/pdb4jz4/pdb
Classification: SIGNALING PROTEIN Organism(s): Caldanaerobius
Deposited: 2013-04-02 Deposition Author(s): Camara-Artigas, A.
Crystal structure of chicken c-src-sh3 domain: monomeric form
Primary Citation of Related Structures: 4JZ4
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Proto-oncogene tyrosine-protein kinase Src | A | 61 | Caldanaerobius | GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPSD |
Proto-oncogene tyrosine-protein kinase Src | B | 61 | Caldanaerobius | GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPSD |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-04-02 Deposition Author(s): Camara-Artigas, A.