Crystal structure of the chicken c-src-sh3 domain intertwined dimer
PDB DOI: 10.2210/pdb4jz3/pdb
Classification: SIGNALING PROTEIN Organism(s): Gallus Gallus
Deposited: 2013-04-02 Deposition Author(s): Camara-Artigas, A.
Method: X-RAY DIFFRACTION Resolution: 1.852 Å
Crystal structure of the chicken c-src-sh3 domain intertwined dimer
Primary Citation of Related Structures: 4JZ3
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Proto-oncogene tyrosine-protein kinase Src | A | 61 | Gallus Gallus | GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPSD |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-04-02 Deposition Author(s): Camara-Artigas, A.