Ripd (rv1566c) from mycobacterium tuberculosis: a non-catalytic nlpc/p60 domain protein, adaptation to peptidoglycan-binding function
PDB DOI: 10.2210/pdb4jxb/pdb
Classification: CELL INVASION Organism(s): Mycobacterium Tuberculosis
Deposited: 2013-03-28 Deposition Author(s): Both, D. , Schneider, G. , Schnell, R. , Steiner, E.M.
Ripd (rv1566c) from mycobacterium tuberculosis: a non-catalytic nlpc/p60 domain protein, adaptation to peptidoglycan-binding function
Both, D. , Schneider, G. , Schnell, R. , Steiner, E.M.
Primary Citation of Related Structures: 4JXB
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Invasion-associated protein | A | 134 | Mycobacterium Tuberculosis | SMDYQQITDVVIARGLSQRGVPFSWAGGGISGPTRGTGTGINTVGFDASGLIQYAYAGAGLKLPRSSGQMYKVGQKVLPQQARKGDLIFYGPEGTQSVALYLGKGQMLEVGDVVQVSPVRTNGMTPYLVRVLGT |
| Invasion-associated protein | B | 134 | Mycobacterium Tuberculosis | SMDYQQITDVVIARGLSQRGVPFSWAGGGISGPTRGTGTGINTVGFDASGLIQYAYAGAGLKLPRSSGQMYKVGQKVLPQQARKGDLIFYGPEGTQSVALYLGKGQMLEVGDVVQVSPVRTNGMTPYLVRVLGT |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-03-28 Deposition Author(s): Both, D. , Schneider, G. , Schnell, R. , Steiner, E.M.