The structure of cyay from burkholderia cenocepacia
PDB DOI: 10.2210/pdb4jpd/pdb
Classification: METAL BINDING PROTEIN Organism(s): Burkholderia Cenocepacia
Deposited: 2013-03-19 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
The structure of cyay from burkholderia cenocepacia
Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Primary Citation of Related Structures: 4JPD
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protein CyaY | A | 112 | Burkholderia Cenocepacia | GPGSMSDTEYLARAEAVLAAVERTVDVANDGDHDIDLERNGSVLTLTFENGSKIIVNLQPPMKEVWIAAKAGGFHYRFIDGEWRDTRTGTEFFSALTDYATQQAGLPITFSA |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-03-19 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease (Ssgcid)