Cftr associated ligand (cal) pdz domain bound to hpv18 e6 oncoprotein c-terminal peptide (rlqrrretqv)
PDB DOI: 10.2210/pdb4jor/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2013-03-18 Deposition Author(s): Amacher, J.F. , Madden, D.R.
Method: X-RAY DIFFRACTION Resolution: 1.34 Å
Cftr associated ligand (cal) pdz domain bound to hpv18 e6 oncoprotein c-terminal peptide (rlqrrretqv)
Primary Citation of Related Structures: 4JOR
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Golgi-associated PDZ and coiled-coil motif-containing protein | A | 87 | Homo Sapiens , Synthetic Construct | GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV |
| Golgi-associated PDZ and coiled-coil motif-containing protein | B | 87 | Homo Sapiens , Synthetic Construct | GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV |
| Protein E6 | C | 10 | Homo Sapiens , Synthetic Construct | RLQRRRETQV |
| Protein E6 | D | 10 | Homo Sapiens , Synthetic Construct | RLQRRRETQV |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-03-18 Deposition Author(s): Amacher, J.F. , Madden, D.R.