Cftr associated ligand (cal) pdz bound to hpv16 e6 oncoprotein c-terminal peptide (trretql)
PDB DOI: 10.2210/pdb4jop/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2013-03-18 Deposition Author(s): Amacher, J.F. , Madden, D.R.
Cftr associated ligand (cal) pdz bound to hpv16 e6 oncoprotein c-terminal peptide (trretql)
Primary Citation of Related Structures: 4JOP
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Golgi-associated PDZ and coiled-coil motif-containing protein | A | 87 | Homo Sapiens , Synthetic Construct | GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV |
Golgi-associated PDZ and coiled-coil motif-containing protein | B | 87 | Homo Sapiens , Synthetic Construct | GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV |
Protein E6 | C | 7 | Homo Sapiens , Synthetic Construct | TRRETQL |
Protein E6 | D | 7 | Homo Sapiens , Synthetic Construct | TRRETQL |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-03-18 Deposition Author(s): Amacher, J.F. , Madden, D.R.