Cftr associated ligand (cal) domain bound to peptide f-ical36 (ansrfptsii)
PDB DOI: 10.2210/pdb4joj/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2013-03-18 Deposition Author(s): Amacher, J.F. , Madden, D.R.
Method: X-RAY DIFFRACTION Resolution: 1.2 Å
Cftr associated ligand (cal) domain bound to peptide f-ical36 (ansrfptsii)
Primary Citation of Related Structures: 4JOJ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Golgi-associated PDZ and coiled-coil motif-containing protein | A | 87 | Homo Sapiens , Synthetic Construct | GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV |
Golgi-associated PDZ and coiled-coil motif-containing protein | B | 87 | Homo Sapiens , Synthetic Construct | GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV |
F-iCAL36 peptide | C | 10 | Homo Sapiens , Synthetic Construct | ANSRFPTSII |
F-iCAL36 peptide | D | 10 | Homo Sapiens , Synthetic Construct | ANSRFPTSII |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-03-18 Deposition Author(s): Amacher, J.F. , Madden, D.R.