Increasing the efficiency efficiency of ligands for the fk506-binding protein 51 by conformational control: complex of fkbp51 with 6-({(1s,5r)-3-[2-(3,4-dimethoxyphenoxy)ethyl]-2-oxo-3,9-diazabicyclo[3.3.1]non-9-yl}sulfonyl)-1,3-benzothiazol-2(3h)-one
PDB DOI: 10.2210/pdb4jfl/pdb
Classification: ISOMERASE Organism(s): Homo Sapiens
Deposited: 2013-02-28 Deposition Author(s): Bracher, A. , Fabian, A. , Gopalakrishnan, R. , Hausch, F. , Hoogeland, B. , Kirschner, A. , Koch, U. , Kozany, C. , Kress, C. , Wang, Y.
Increasing the efficiency efficiency of ligands for the fk506-binding protein 51 by conformational control: complex of fkbp51 with 6-({(1s,5r)-3-[2-(3,4-dimethoxyphenoxy)ethyl]-2-oxo-3,9-diazabicyclo[3.3.1]non-9-yl}sulfonyl)-1,3-benzothiazol-2(3h)-one
Bracher, A. , Fabian, A. , Gopalakrishnan, R. , Hausch, F. , Hoogeland, B. , Kirschner, A. , Koch, U. , Kozany, C. , Kress, C. , Wang, Y.
Primary Citation of Related Structures: 4JFL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Peptidyl-prolyl cis-trans isomerase FKBP5 | A | 128 | Homo Sapiens | GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-02-28 Deposition Author(s): Bracher, A. , Fabian, A. , Gopalakrishnan, R. , Hausch, F. , Hoogeland, B. , Kirschner, A. , Koch, U. , Kozany, C. , Kress, C. , Wang, Y.