Crystal structure of the n114a mutant of the abl-sh3 domain complexed with the high affinity peptide p0
PDB DOI: 10.2210/pdb4j9d/pdb
Classification: Transferase/unknown function Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2013-02-16 Deposition Author(s): Camara-Artigas, A.
Crystal structure of the n114a mutant of the abl-sh3 domain complexed with the high affinity peptide p0
Primary Citation of Related Structures: 4J9D
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Tyrosine-protein kinase ABL1 | A | 63 | Homo Sapiens , Synthetic Construct | MENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSAYITPVNS |
| Tyrosine-protein kinase ABL1 | C | 63 | Homo Sapiens , Synthetic Construct | MENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSAYITPVNS |
| Tyrosine-protein kinase ABL1 | E | 63 | Homo Sapiens , Synthetic Construct | MENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSAYITPVNS |
| P0 | B | 11 | Homo Sapiens , Synthetic Construct | XAPTYPPPLPP |
| P0 | D | 11 | Homo Sapiens , Synthetic Construct | XAPTYPPPLPP |
| P0 | F | 11 | Homo Sapiens , Synthetic Construct | XAPTYPPPLPP |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-02-16 Deposition Author(s): Camara-Artigas, A.