Crystal structure of the abl-sh3 domain h59q-n96t mutant complexed with the designed high-affinity peptide ligand p17
PDB DOI: 10.2210/pdb4j9c/pdb
Classification: Transferase/unknown function Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2013-02-16 Deposition Author(s): Camara-Artigas, A.
Crystal structure of the abl-sh3 domain h59q-n96t mutant complexed with the designed high-affinity peptide ligand p17
Primary Citation of Related Structures: 4J9C
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Tyrosine-protein kinase ABL1 | A | 63 | Homo Sapiens , Synthetic Construct | MENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNQTGEWCEAQTKNGQGWVPSNYITPVNS |
| P17 | B | 11 | Homo Sapiens , Synthetic Construct | XAPTYSPPLPP |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-02-16 Deposition Author(s): Camara-Artigas, A.