Crystal structure of the dimerization domain of hsc70-interacting protein
PDB DOI: 10.2210/pdb4j8c/pdb
Classification: CHAPERONE Organism(s): Rattus Norvegicus
Deposited: 2013-02-14 Deposition Author(s): Bracher, A. , Li, Z.
Method: X-RAY DIFFRACTION Resolution: 1.1 Å
Crystal structure of the dimerization domain of hsc70-interacting protein
Primary Citation of Related Structures: 4J8C
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Hsc70-interacting protein | A | 46 | Rattus Norvegicus | GAMDPRKVSELRAFVKMCRQDPSVLHTEEMRFLREWVESMGGKVPP |
| Hsc70-interacting protein | B | 46 | Rattus Norvegicus | GAMDPRKVSELRAFVKMCRQDPSVLHTEEMRFLREWVESMGGKVPP |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-02-14 Deposition Author(s): Bracher, A. , Li, Z.