Crystal structure of multidrug resistant hiv-1 protease clinical isolate pr20 in complex with amprenavir
PDB DOI: 10.2210/pdb4j5j/pdb
Classification: HYDROLASE/HYDROLASE INHIBITOR Organism(s): Human Immunodeficiency Virus 1
Deposited: 2013-02-08 Deposition Author(s): Shen, C.H. , Weber, I.T.
Method: X-RAY DIFFRACTION Resolution: 1.8 Å
Crystal structure of multidrug resistant hiv-1 protease clinical isolate pr20 in complex with amprenavir
Primary Citation of Related Structures: 4J5J
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protease | A | 99 | Human Immunodeficiency Virus 1 | PQITLWKRPFVTVKVGGQLKEALLDTGADNTIFEDINLPGRWKPKMVGGIGGFLKVREYDQVPIEIAGHKVIGTVLVGPTPVNVIGRDTMTQIGATLNF |
| Protease | B | 99 | Human Immunodeficiency Virus 1 | PQITLWKRPFVTVKVGGQLKEALLDTGADNTIFEDINLPGRWKPKMVGGIGGFLKVREYDQVPIEIAGHKVIGTVLVGPTPVNVIGRDTMTQIGATLNF |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-02-08 Deposition Author(s): Shen, C.H. , Weber, I.T.