PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

4J48

Crystal structure of xiap-bir2 domain with amrv bound

PDB DOI: 10.2210/pdb4j48/pdb

Classification: APOPTOSIS
Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)

Deposited: 2013-02-06
Deposition Author(s): Gosu, R.

Experimental Data Snapshot

Method: X-RAY DIFFRACTION
Resolution: 2.1 Å

Literature

Crystal structure of xiap-bir2 domain with amrv bound

Gosu, R.

Primary Citation of Related Structures: 4J48


Proteins
Molecule Chains Sequence Length Organism Sequence
E3 ubiquitin-protein ligase XIAP A 86 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) GTIYPRNPAMYSEEARLKSFQNWPDYAHLTPRELASAGLYYTGIGDQVQCFACGGKLKNWEPGDRAWSEHRRHFPNCFFVLGRNLN
E3 ubiquitin-protein ligase XIAP C 86 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) GTIYPRNPAMYSEEARLKSFQNWPDYAHLTPRELASAGLYYTGIGDQVQCFACGGKLKNWEPGDRAWSEHRRHFPNCFFVLGRNLN
PEPTIDE (ALA-MET-ARG-VAL) B 4 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) AMRV
Experimental Data

Method: X-RAY DIFFRACTION

Deposited Date: 2013-02-06
Deposition Author(s): Gosu, R.