4J3H
Ring cycle for dilating and constricting the nuclear pore: structure of a nup54 homo-tetramer.
PDB DOI: 10.2210/pdb4j3h/pdb
Classification: TRANSPORT PROTEIN Organism(s): Rattus Norvegicus
Deposited: 2013-02-05 Deposition Author(s): Blobel, G. , Melcak, I. , Solmaz, S.R.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.5002 Å
Ring cycle for dilating and constricting the nuclear pore: structure of a nup54 homo-tetramer.
Blobel, G. , Melcak, I. , Solmaz, S.R.
Primary Citation of Related Structures: 4J3H
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Nuclear pore complex protein Nup54 | A | 46 | Rattus Norvegicus | GSHMEEKYYMDADLLREIKQHLKQQQEGLSHLMSIIKDDLEDIKLV |
| Nuclear pore complex protein Nup54 | B | 46 | Rattus Norvegicus | GSHMEEKYYMDADLLREIKQHLKQQQEGLSHLMSIIKDDLEDIKLV |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2013-02-05 Deposition Author(s): Blobel, G. , Melcak, I. , Solmaz, S.R.